Spotted on Shelves...

Healthier_Me
Healthier_Me Posts: 5,600 Member
edited September 2024 in Food and Nutrition
3711readypac6.jpg

Ready Pac Snack Pacs - We LOVE portion-controlled snacks and creative little food "projects" -- that's why we're flipping over these fruity little items. They're fun packages stocked with individual compartments of various fruits, dips, and toppings. We've spied three varieties -- Mango & Blueberry (Mango, Blueberries & Lemon Dip), Piña Colada (Pineapple, Grapes, Vanilla Dip & Coconut Flakes), and Apple Granola Yogurt (Apples, Vanilla Yogurt & Granola). Each pack has 100 - 110 calories, 1 - 3g fat, 20 - 24g carbs, 1 - 2g fiber, and 1 - 3g protein (POINTS® value 2*). That rocks! Find them in the produce section at select markets.

Fiber One Premium Muffin Mix, Banana Nut - Yup, it's ANOTHER flavor of Fiber One boxed muffin mix. A quarter-cup of the mix itself -- one muffin's worth -- has 130 calories, 3g fat, 27g carbs, 5g fiber, and 3g protein (POINTS® value 2*). Ooooh, and look for the reduced-fat directions on the side of the box! Follow those, and each baked muffin will clock in with just 140 calories and 3g fat (POINTS® value 2*). Woohoo! BTW, if you follow the regular directions, your muffin will have 160 calories and 6g fat (POINTS® value 3*).

Refrigerated Almond Breeze Non-Dairy Milk Alternative - Heads up! Our favorite milk swap is no longer only found in the shelf-stable boxed milk section of stores. It can now be found next to all the regular milks in the chilled dairy section of select markets (it's currently in limited distribution). But WATCH OUT -- the folks behind these beverages have NOT launched their UNSWEETENED versions in these fridge-bound containers. So the ones you'll see in the fridge section -- in Original, Vanilla, and Chocolate -- contain sugar and have WAY more calories than the unsweetened kind we use in our recipes. (The sweetened ones have 60 - 120 calories, while the unsweetened ones have 40 - 45.)


**Secret Foods Worth Seeking Out...

*Fruit Pearls
fruitpearls2.jpg

These little-known snacks are hard to find but WORTH the search!

These are little beads of frozen fruit, yogurt, chocolate, etc., and they come in cute, portion-controlled cups! Each container has just 50 - 140 calories, 0 - 9g fat, 12 - 17g carbs, 4 - 6g fiber, and 0 - 4g protein (POINTS® value 0 - 3*). And there are a bazillion flavors (okay, 9... but 9 AMAZING flavors!). WE LOVE THESE!!! BTW, most flavors are fat-free -- only the chocolatey ones contain fat. For now, unfortunately, you need to order 'em online.


*Tillen Farms Pickled Crispy Veggies

tillenfarmspickledcrispyveggies3.jpg

If you enjoy pickles and pickled things, you're gonna FREAK over these jars of pickled veggies (we did!) -- everything from carrots to green beans. They're low-cal, delicious, and some are even SPICY. Enjoy a serving (3 to 5 pieces or 1/4 cup) for 10 - 30 calories, 0g fat, 1 - 7g carbs, 0 - 1g fiber, and 0 - 1g protein (POINTS® value 0*). Yup, you have to get these online as well (unless you're lucky, and a nearby store stocks 'em).


*FoodShouldTasteGood Sweet Potato Tortilla Chips

foodshouldtastegoodsweetpotatochips3.jpg

Warning, these chips are so good, you'll want to inhale the whole bag in one sitting. Just being honest here. These are tortilla chips made with potato (not to be confused with potato chips!). A serving of about 10 chips clocks in with 130 calories, 6g fat, 18g carbs, 3g fiber, and 2g protein (POINTS® value 3*). Find 'em online and at select natural foods stores, or go here to see where they're sold.- http://www.foodshouldtastegood.com/findus.asp

Replies

  • Healthier_Me
    Healthier_Me Posts: 5,600 Member
    3711readypac6.jpg

    Ready Pac Snack Pacs - We LOVE portion-controlled snacks and creative little food "projects" -- that's why we're flipping over these fruity little items. They're fun packages stocked with individual compartments of various fruits, dips, and toppings. We've spied three varieties -- Mango & Blueberry (Mango, Blueberries & Lemon Dip), Piña Colada (Pineapple, Grapes, Vanilla Dip & Coconut Flakes), and Apple Granola Yogurt (Apples, Vanilla Yogurt & Granola). Each pack has 100 - 110 calories, 1 - 3g fat, 20 - 24g carbs, 1 - 2g fiber, and 1 - 3g protein (POINTS® value 2*). That rocks! Find them in the produce section at select markets.

    Fiber One Premium Muffin Mix, Banana Nut - Yup, it's ANOTHER flavor of Fiber One boxed muffin mix. A quarter-cup of the mix itself -- one muffin's worth -- has 130 calories, 3g fat, 27g carbs, 5g fiber, and 3g protein (POINTS® value 2*). Ooooh, and look for the reduced-fat directions on the side of the box! Follow those, and each baked muffin will clock in with just 140 calories and 3g fat (POINTS® value 2*). Woohoo! BTW, if you follow the regular directions, your muffin will have 160 calories and 6g fat (POINTS® value 3*).

    Refrigerated Almond Breeze Non-Dairy Milk Alternative - Heads up! Our favorite milk swap is no longer only found in the shelf-stable boxed milk section of stores. It can now be found next to all the regular milks in the chilled dairy section of select markets (it's currently in limited distribution). But WATCH OUT -- the folks behind these beverages have NOT launched their UNSWEETENED versions in these fridge-bound containers. So the ones you'll see in the fridge section -- in Original, Vanilla, and Chocolate -- contain sugar and have WAY more calories than the unsweetened kind we use in our recipes. (The sweetened ones have 60 - 120 calories, while the unsweetened ones have 40 - 45.)


    **Secret Foods Worth Seeking Out...

    *Fruit Pearls
    fruitpearls2.jpg

    These little-known snacks are hard to find but WORTH the search!

    These are little beads of frozen fruit, yogurt, chocolate, etc., and they come in cute, portion-controlled cups! Each container has just 50 - 140 calories, 0 - 9g fat, 12 - 17g carbs, 4 - 6g fiber, and 0 - 4g protein (POINTS® value 0 - 3*). And there are a bazillion flavors (okay, 9... but 9 AMAZING flavors!). WE LOVE THESE!!! BTW, most flavors are fat-free -- only the chocolatey ones contain fat. For now, unfortunately, you need to order 'em online.


    *Tillen Farms Pickled Crispy Veggies

    tillenfarmspickledcrispyveggies3.jpg

    If you enjoy pickles and pickled things, you're gonna FREAK over these jars of pickled veggies (we did!) -- everything from carrots to green beans. They're low-cal, delicious, and some are even SPICY. Enjoy a serving (3 to 5 pieces or 1/4 cup) for 10 - 30 calories, 0g fat, 1 - 7g carbs, 0 - 1g fiber, and 0 - 1g protein (POINTS® value 0*). Yup, you have to get these online as well (unless you're lucky, and a nearby store stocks 'em).


    *FoodShouldTasteGood Sweet Potato Tortilla Chips

    foodshouldtastegoodsweetpotatochips3.jpg

    Warning, these chips are so good, you'll want to inhale the whole bag in one sitting. Just being honest here. These are tortilla chips made with potato (not to be confused with potato chips!). A serving of about 10 chips clocks in with 130 calories, 6g fat, 18g carbs, 3g fiber, and 2g protein (POINTS® value 3*). Find 'em online and at select natural foods stores, or go here to see where they're sold.- http://www.foodshouldtastegood.com/findus.asp
  • Anna_Banana
    Anna_Banana Posts: 2,939 Member
    Wow, I wish I lived somewhere with a big grocery store. There is none of that on the shelves here.:frown:
This discussion has been closed.